London Jobs |
Manchester Jobs |
Liverpool Jobs |
Nottingham Jobs |
Birmingham Jobs |
Cambridge Jobs |
Glasgow Jobs |
Bristol Jobs |
Wales Jobs |
London Jobs |
Manchester Jobs |
Liverpool Jobs |
Nottingham Jobs |
Birmingham Jobs |
Cambridge Jobs |
Glasgow Jobs |
Bristol Jobs |
Wales Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
World Class Defence Organisation based in Bristol is currently looking to recruit 2x Low level Embedded Software Engineer subcontractors on an initial 6 month...
Position Available: Environmental Domain Lead (Electromagnetic Compatibility)
Location: Bristol or Stevenage - Dynamic Working Hours (Hybrid 50% home working)
Our esteemed client, a trusted partner of the UK Ministry of Defence, are seeking a proficient Software Engineer with expertise in C# and C++. The role entails integrating real products, model...
About the role Something exciting is happening at Booker! Come and join the fastest-growing food and drink wholesaler in the UK! We will consider both full time and part time...
World Class Defence Organisation is currently looking to recruit an RF Systems Design Engineer Subcontractor on an initial 12 month contract. The role will be a hybrid of working from home (at...
Lockheed Martin is recruiting for 2 x Senior Craft Fitter to join our team based from RNAD Coulport, Helensburgh. This role benefits from a 4-day working week...
I am currently recruiting for a Senior Business Support Officer to work at a leading public sector organisation based in Sheffield (S1 postcode). The team are passionate about suppor...
About the role Something exciting is happening at Booker! Come and join the fastest-growing food and drink wholesaler in the UK! We continue to grow!We hav...
About the role Something exciting is happening at Booker! Come and join the fastest-growing food and drink wholesaler in the UK! We continue to grow!We hav...
Please note this is a hybrid role, with some in-person attendance plus training in Nottingham. If you naturally love helping people and making a positive impact through tech support, this co...
“Education is the most powerful weapon which you can use to change the world.” Nelson Mandela. Sheridan Maine is collaborating with a prominent Academy Trust based in Bi...
Technical Trainer / Instructor (Engineering) About the Role: - Unique opportunity in a world-renowned defence company vital to the UKs national security. - Move into a different in...
Location: Bristol Hourly Rate: £40.00 - £45.00ph Umbrella (PAYE available, Inside IR35) Working Requirements: Fully onsite Contr...
Communications Officer Ref: CO(24)/FMC Department: Fundraising, Marketing and Communications Salary: £30,757 per annum Working pattern: 37.5 hours per week, Monday to Fri...
Campaigns Communications Copywriting Engagement PR Public Engagement Social Media Building Relationships Offline Marketing Online CommunicationsAre you passionate about building understanding and support for nature Do you have the skills, knowledge and experience to lead WWT’s communications and ensure we reach a wide range of audiences F...
Campaigns Communications Management Experience Public EngagementWorld Class Defence Organisation is currently looking to recruit an RF Systems Design Engineer Subcontractor on an initial 12 month contract. The role will be a hybrid of working from home (at...
World Class Defence Organisation is currently looking to recruit an RF Systems Design Engineer Subcontractor on an initial 12 month contract. The role will be a hybrid of working from home (at...
Job Title: 360 Recruitment Consultant Extraordinaire Location: Lutterworth LE17 (where the coffee never stops flowing) - Salary: £25K - £...
B2BRecruitmentSalesNew BusinessWorld Class Defence Organisation (the role can be a split of working Onsite and Working From Home) is currently looking to recruit 5x Electronics Design Engineer subcontractors on an initial 1...
Daily Supply Teacher needed in Harrow! Are you a fantastic teacher seeking part time flexible work in the Harrow area If so, I would very much like to speak to you, I am actively wo...
About the role Something exciting is happening at Booker! Come and join the fastest-growing food and drink wholesaler in the UK! We continue to grow!We hav...
About the role Something exciting is happening at Booker! Come and join the fastest-growing food and drink wholesaler in the UK! We continue to grow!We hav...
About the role There’s something exciting happening at Booker! Come and join the fastest growing food and drink wholesaler in the UK! We continue to grow!
Manufacturing Test Engineering Team Lead Salary: Up to £48,000 + Company Bonus & Paid Overtime Location: Bolton (mostly office based) & Flexi-hour...
Do you have a background in Electronics with a passion for shaping the next generation Your journey to becoming an Instructor starts here! Destination: Cutting-edge Innovation Join ...
ElectronicsAre you an Engineer who is passionate about the defence of the United Kingdom and looking to develop your skills At Defence Equipment and Support (DE&S), were looking for Junior Weapons Engineers to j...
Brand Account / Relationship Manager Our client is the UK’s largest distributor to convenience retailers, based in the heart of Birmingham in a brand-new office minutes from trans...
Account Management Negotiation Networking Relationship Management SalesAre you a people person, forging a career in sales Perhaps you just know you’re great at building relationships with people quickly Or maybe you’re in customer services and love speaking to custom...
Your experience of System Engineering, (specifically Verification Engineering) and knowledge of requirements and testing will help you to work across the systems, software, and hardware domains to own...
VerificationJob title: Senior Engineer - Product Assurance Location: Barrow or Filton. We offer a range of hybrid and flexible working arrangements - please speak to your recruiter about the optio...
Job summary At Defence Equipment & Support (DE&S), were here to provide for the Armed Forces, as they serve our country all over the world. We support those on the front line by providing cutting-edg...
What sets DE&S apart is the focus we put on you. We help you find your flair and then plan a flourishing career around what you love. And along the way, you’ll enjoy real rewards for the work you do...
Are you looking for a hands-on role in a new environment Our client is on the lookout for an enthusiastic Warehouse Operative to join our bustling warehouse in Blyth. No previous experience No problem...
Software Engineer (Virtualisation & DevOps)
Bristol
Salary: Circa £50,000 - £70,000 depending on experience
Job Title: Legal Services Network Manager: The Ultimate Power Move Description: Welcome to the world of high-stakes business and relentless ambition.My client is along-established and growing prof...
Job Title: Technical Engineer Lead (T3E Delivery) Location: West Freugh, Eskmeals or Shoeburyness Working Model: Hybrid - Travel to client sites is ...
T3E Systems Engineer MoD Defence Delivery Technical Engineering Sensor Fusion SystemsSystems Engineer Employment Type - Full Time Site Location: Bristol | Bolton | Stevenage - Onsite 4 - 5 Days per week *...
Your experience of systems integration, and knowledge of systems validation / test activities will help you to make a difference to the to the Integration and System Validation team for the Mission Su...
IntegrationWeapons Technician (Progress to Trainer / Lecturer) £32,000 - £34,000 + Full Teacher Training Level 4 + Tailored Development and Training Programme...
HNCMarineMechanicMilitaryNVQTankTeacherTrainingTruckWeaponsHNDEngineerWeaponWeapons TechnicianArmorerArmor C&GWeapon Systems Engineers - Defence and Military Systems - Permanent Attractive - West Midlands or North-East, Hybrid Weapon Systems Engineer...
Multiple Systems Acceptance Engineers - Defence and Military Systems Permanent - Attractive - Bristol or West Midlands Systems Acceptance Engi...
Were Defence Equipment and Support (DE&S). We manage a vast range of projects to supply and maintain vital equipment and services for the Royal Navy, British Army and Royal Air Force. Together, we del...
DefenceMilitaryMODQuality AssuranceRisk ManagementAre you the glue the keeps everything together In a manufacturing process every department of the assembly team has their part to play, you are quite literally the person who glues t...
World Class Defence Organisation based in Bristol or Stevenage (you can be based from either site, depending on your preference) is currently looking to recruit a Simulation Project Lead (Soft...
The Role: As Head of Biddable & Performance you will take full ownership of our global biddable initiatives. Leading the paid search, paid social, and programmatic teams, you will de...
Would you like the opportunity to work across and attend trials for Land Equipment and Ordnance, Munitions and Explosives (OME) Our experienced Land organisation is actively looking for Engineers with...
DefenceEngineeringSafetySafety RegulationsSDA have an exciting opportunity for an experienced Weapons Safety Engineering professional to join our Trident Systems Project Team (TSPT) at HMNB Clyde, Faslane. By joining TSPT, you will integrate ...
World Class Defence Organisation is currently looking to recruit System Performance Engineer / Simulation and Modelling Engineersubcontractor on an initial 18...
Your experience of systems engineering and strong background in Requirements Management will help you to lead the development and maintenance of the software requirements across all of the maritime pr...
Systems RequirementsWorld Class Defence Organisation based in Stevenage and Bristol is currently looking to recruit a Bid Manager subcontractor on an initial 12 month contract. The role will likely be a mixture o...
Weapons Engineering Officer (Defense / Naval / Navy) £55,000 - £65,000 Remote + Tailored development and training programme + Progression ...
CivilDefenceEngineeringMaintenanceMarineRailSupervisorCombatNavalContractHybridNorthern IrelandDockyardBAEBabcockBalfourWeapons Engineer (Defense / Naval / Navy) £50,000 - £57,000 Remote + Tailored Training Programme + Progression + Pension Scheme + ...
CivilDefenceEngineeringMaintenanceMarineCombatNavalContractHybridDockyardBAEBabcockBalfourWeapons Technician (Defense / Naval / Navy) £40,000 - £48,000 Remote + Tailored Training Programme + Progression + Pension Scheme +...
CivilDefenceEngineeringMaintenanceMarineRailSupervisorCombatNavalContractHybridNorthern IrelandDockyardBAEBabcockBalfourWeapons Engineering Officer (Defense / Naval / Navy) £55,000 - £65,000 Remote+ Tailored development and training programme + Progression &...
CivilDefenceEngineeringMaintenanceMarineRailSupervisorCombatNavalContractHybridNorthern IrelandDockyardBAEBabcockBalfourWeapons Engineer (Defense / Naval / Navy) £50,000 - £57,000 Remote + Tailored Training Programme + Progression + Pension Scheme + ...
CivilDefenceEngineeringMaintenanceMarineRailSupervisorCombatNavalContractHybridNorthern IrelandDockyardBAEBabcockBalfourWeapons Technician (Defense / Naval / Navy) £40,000 - £48,000 Remote + Tailored Training Programme + Progression + Pension Scheme + Eligibility To Join Sha...
CivilDefenceEngineeringMarinePrincipalShipShipbuildingCombatSeniorEngineerBristolNavalContractPlymouthHybridDockyardBAEBabcockRosythBalfourWeapons Technician (Defense / Naval / Navy) £40,000 - £48,000 Remote + Tailored Training Programme + Progression + Pension Scheme + Eligibility To Join Sha...
CivilDefenceEngineeringMaintenanceMarineRailSupervisorCombatNavalContractHybridNorthern IrelandDockyardBAEBabcockBalfourWeapons Engineer (Defense / Naval / Navy) £50,000 - £57,000 Remote + Tailored Training Programme + Progression + Pension Scheme + ...
CivilDefenceEngineeringMaintenanceMarineCombatNavalContractHybridDockyardBAEBabcockBalfourWeapons Technician (Defense / Naval / Navy) £40,000 - £48,000 Remote + Tailored Training Programme + Progression + Pension Scheme +...
CivilDefenceEngineeringMaintenanceMarineRailSupervisorCombatNavalContractHybridNorthern IrelandDockyardBAEBabcockBalfourWorld Class Defence Organisation based in Bristol or Stevenage (you can be based from either site, depending on your preference) is currently looking to recruit a Simulation Project Lead (Soft...
World Class Defence Organisation based in Bristol is currently looking to recruit 4x Verification / Validation Systems Engineers subcontractors on an initial 12 month contract.
Systems Engineer - £70per hour inside ir35 - 12 months (extension highly likely) - Bristol - one stage virtual interview - Current SC clearance required - Sector: Aerospace & Defence systems engineer
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
An opportunity has arisen with my client for a Safety Engineer to join them on a 6 month contract. My client is looking for an engineer to exploit their safety engineering skills to influence the safe...
SAFETY ENGINEER - INSIDE IR35 - Up to £60 per hour - BRISTOL (60/40 HYBRID SPLIT) - SC CLEARED - 6 MONTHS - SINGLE STAGE INTERVIEW Yolk Recruitment are recruiting for a Safety E...
Embedded Software Engineer Employment Type - Full Time Location: Onsite in Bristol 3 -5 Days per week *Must hold a Briti...
The Role: As a Programmatic Manager you will take full ownership of our global programmatic initiatives. Working closely with the programmatic trader, you will design market-specific...
The Role: The Senior Digital Content Managerwill be passionate about digital marketing, content and tech with rich experience in planning and executing creative and commercial, digit...
SEN Teaching Assistant
Location: Croydon
Full Time/Part time
Negotiable Rates
Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
SEN Teaching Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP
Learning Support Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP<...
Learning Support Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP<...
Learning Support Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP<...
Learning Support Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP<...
Learning Support Assistant Location: Croydon & Sutton Full Time/Part time Negotiable Rates Interviews taking place ASAP<...
We are Defence Equipment and Support (DE&S). We make sure the UK military is equipped, supported, and connected, as they protect life at home and overseas. We manage a vast range of complex projects t...
EngineeringSafetySoftware Project Manager Initial 6 Month Contract Inside IR35 Bristol or Stevenage Hybrid/Weekly Site Visits ...
Software Project ManageerWe are Defence Equipment and Support (DE&S). We make sure the UK military is equipped, supported, and connected, as they protect life at home and overseas. We manage a vast range of complex projects t...
LeadershipMODSafetySafety EngineeringSystem SafetyWorld Class Defence Organisation based in Bristol and Stevenage is currently looking to recruit a C# / C++ Software/Simulation Engineer subcontractor on an initial 12 month contract. T...
We are currently recruiting for a self managing Field Service Engineer to work from our Terminal at Mount Sorrel in Leicestershire The successful candidate will be responsible for the daily maintenan...
MechanicMilitaryFitterMobile PlantTractors and AgriculturalWorld Class Defence Organisation based in Stevenage and Bristol is currently looking to recruit a Bid Manager subcontractor on an initial 12 month contract. The role will likely be a mixture o...
World Class Defence Organisation based in Stevenage and Bristol (this role can be Home based with time spent onsite if project dependant) is currently looking to recruit a C++ / C# Sof...
World Class Defence Organisation based in Bristol is currently looking to recruit a Systems Engineersubcontractor on an initial 12 month contract. Hourly Rate: ...
Systems Equipment Architect Location: Bristol Salary: £40,000 - £50,000 + Overtime, bonus, pension, flexible working and more We have an exciting opportunity for a nu...
EngineeringEngineering DesignSystem DesignsystemsJob Title: Senior Mission Systems Engineer Location: Bristol or Plymouth or Rosyth, UK - Hybrid - working from home options available Compensation: Competitive Salary + benefits Role Type: Full ti...
Job Title: Mission Systems Engineer Location: Bristol or Plymouth or Rosyth, UK - Hybrid - working from home options available Compensation: Competitive Sala...
Job Title: Mission Systems Engineer Location: Bristol or Plymouth or Rosyth, UK - Hybrid - working from home options available Compensation: Competitive Sala...
Systems Engineer required for long term contract assignments based in Bristol for a multi national defenc company. The role is within the Weapon Systems Design & Verification team, supporting the sus...
aerospacedefenceengineeringsystemsweaponsmissileWorld Class Defence Organisation based in Bristol is currently looking to recruit a Systems Engineersubcontractor on an initial 12 month contract. Hourly Rate: ...
Maintenance Technician (Contract until July 2023) Maintenance Technician needed for a highly reputable defence and aerospace organisation with this role based in Lakenheath. The ro...
Guidant Global is working with the UKs trusted Ministry of Defence partner, MBDA, who needs a qualified GCN Engineer to develop Missile and Weapon Systems algorithms across a wide range of defence pro...
Human Factors Engineer - 12 Month Contract (Extensions Likely) - Up to £85 per Hour (Inside IR35) - Bristol - Hybrid Working (2/3 days per week remote) - BPSS / SC ClearanceRequired - 1 S...
© 2019 Naukrijobs All Rights Reserved