London Jobs |
Manchester Jobs |
Liverpool Jobs |
Nottingham Jobs |
Birmingham Jobs |
Cambridge Jobs |
Glasgow Jobs |
Bristol Jobs |
Wales Jobs |
London Jobs |
Manchester Jobs |
Liverpool Jobs |
Nottingham Jobs |
Birmingham Jobs |
Cambridge Jobs |
Glasgow Jobs |
Bristol Jobs |
Wales Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
About Opencast Opencast is an ambitious, successful, and growing technology consultancy. We pride ourselves in the qualities of our people. Were inclusive, creative, and collaborati...
Walters People - Finance Analyst - Burton - On - Trent - £35,000 per annum Walters People have partnered with a leading property business based in Burton - On - Trent who are looking for a Finan...
Walters People - Finance Business Partner - Burton - On - Trent - £50,000 per annum Walters People have partnered with a leading property business based in Burton - On - Trent who are looking fo...
Application Support Analyst - Derivatives City of London £75,000 per annum I am currently working with an Asset Manager client who is looking ...
analystderivativessupport analystJob Title: BI Data Analyst (Ref: 20729) Location: Staffordshire Salary: £40-45k Job Type: Full Time / Permanent (Monday - Friday) Overview: The newly created BI Developer/Analyst role has be...
Systems Business Analyst Salford, Greater Manchester The Company With a global network spanning the UK, mainland Europe and the USA, DOMU Brands is a growing eComme...
A great opportunity for a junior Commercial Financial Analyst to join a fast-paced retail business based in Stoke-on-Trent. Working within a small team to provide robust analysis and contributing towa...
financial analystadvanced excelfinance graduatecommercial finance analystOverview Utilities KYC, BNY Mellon is looking for a senior technology professional who can independently manage, drive and implement dashboarding and automation solutions on landscape of financ...
Customer Insight Analytics Manager Fast Fashion Brand Salary: £70k - £75k plus bonus Location: Manchester OR London (2 days in o...
CRMcustomerretailmanagermarketingreportinganalystseniorfashionproductanalyticsleadinsightcampaigndata scienceOverview Utilities KYC, BNY Mellon is looking for a senior technology professional who can independently manage, drive and implement dashboarding and automation solutions on landscape of financ...
BI Developer. £50k + Benefits Package. Hybrid role - 1 day a week onsite. Cambridge, Cambridgeshire, Permanent. T6/MN/18268. Leading international organisation is seeking t...
The Pearson Finance teams are currently looking for highly analytical, technical, creative and forward-thinking interns. In return, we will provide you with an unforgettable 9-week placement in a fast...
Assistant Business Information Analyst (Maternity cover, temporary, minimum 12 month contract) Location: Coventry Sector: Packaging Distribution Package: Basic salary £23,000 - &...
QlikViewSQL 2012Microsoft Office 2010 and 2013Information tecnologyVB skills in ExcelData Analyst Liverpool - Hybrid £50K What benefits do they offer on top of an above-market-rate salary
The Senior Workflow Administrator role sits within the Global Content Operations organization. The role interfaces with other areas of the wider business. They are responsible for the sourcing financi...
Exceldataquality assuranceprocess improvementVLOOKUPPivot TableJunior Business Analyst with strong financial analytical skills, who is customer focussed, motivated and well-organised is required for a well-established business based in Leeds, Wes...
Sourcing Specialist Rate: £20 an hour PAYE Duration: Until 25th November Location: Cardiff - Hybrid working Help...
purchasingsupply chainnegotiationssupply coordinationWere currently recruiting a permanent Financial Controller to join a leading manufacturing business in the North East, as Financial Controller, reporting into the Group FC you will have full responsib...
Financial Controller or finance managerSharePoint Developer Swadlincote Up to £50k Hours: 9:00 - 5:30 Job Type: Permanent My client is an expan...
Responsibilities Are you looking for a position where you can make a difference, constantly learn new things and be at the forefront of our award-winning customer service, working as...
Job Title: Data Intelligence Analyst Location: Merseyside, WA10 Pay Rate: £20.49 - £23.44 dependant on experience Hours: 37.5 hours per week Length of the contract: 6 months initially. ...
analystdataData AnalystIntelligence Analystdata intelligenceData Intelligence SpecialistUp to £55,000 multiple locations across the ukHybridExcellent BenefitsSector: Consultancies Yolk Recruitment are recruiting for a Data Intelligence S...
Tableau Power BI Olikview google data studio Knime alteryxData Intelligence SpecialistUp to £48,000 multiple locations across the ukHybridExcellent BenefitsSector: Consultancies Yolk Recruitment are recruiting for a Data Intelligence S...
Tableau Power BI Olikview google data studio Knime alteryxData Intelligence SpecialistUp to £55,000 multiple locations across the ukHybridExcellent BenefitsSector: Consultancies Yolk Recruitment are recruiting for a Data Intelligence S...
Tableau Power BI Olikview google data studio Knime alteryxGraduate Data Analyst Location: Tamworth Hybrid Working Available Gleeson Recruitment Group are delighted to be recruiting for a Graduate Data Analyst to join a company based in Tamworth. Our clien...
data analystJunior ERP Project Manager - London I have a new opportunity to join my growing client in their team as a Junior ERP Project Manager. Salary: £30,000 - £40,000 sqlreportsreportinganalystexcelpythonanalysisdata analysisdata analystcrmqlikviewinsightsmarket datadata sciencetableaudata visualisationalteryxdata acquisitionpower biqlik viewpowerbi
Who we are looking for Your role as Trader Assistant sits within the Agency Lending Trading team in London. The group comprises of Equities and Fixed Income traders. You will support...
Marks Sattin are delighted to be recruiting a senior level opportunity to lead and develop the Lead Advisory - M&A / Corporate Finance team within an established and highly reputable ...
SQLVBATableaufinancial modellingm&avaluationsbusiness modellingcorporate financeLead AdvisoryQlikviewAlteryxbusiness valuationsPower BIData Analyst Location: Tamworth Hybrid Working Available Gleeson Recruitment Group are delighted to be recruiting for a Data Analyst to join a company based in Tamworth. Our clien...
data analystProduction of accurate and timely monthly Financial Forecasts and Budgets. Full P&L, Balance Sheet and Cashflow reporting. Client Details Loughborough based global leader in the de...
ACCACIMApart-qualifiedmanagement accountantOur client a global leading manufacturer business that have sites across the globe are looking to recruit an experienced Management Accountant to their small friendly Finance Team. The role includes ...
Salary: £33-£39k Location: Chelmsford/Cambridge (with hybrid home working) Hours of Work: Full-time (37 hours per week) Role Ove...
OLAPSQLQlikViewData WarehousePower BIService Support Officer Kingston upon Hull Full-time contract 3-Month contract £...
adminadministratorsupport officerbusiness support officerService support officerFantastic opportunity for a Data Analyst to join an established business in Corsham. You will be responsible for providing analysis and reporting of internal systems and presenting this back to the w...
Sales Administrator Location: Harrogate Salary: £22k per year + £4k bonus (£26k altogether) Hours: Monday to Friday betwee...
A BI Developer vacancy is currently available working for a reputable Lloyds Market Insurance company. Following delivery of a new cloud-based data warehouse and BI reporting capability, a new Data M...
Power BIPolish Speaking Customer Service Specialist Hybrid Working £24 - £27k plus amazing benefits package including medical insurance, pension, life as...
Part Time Sales Administrator (Temporary) Gillingham 24 hours per week, ideally across 5 days (Monday - Friday) £10-£12PH dependent on experience My client is seeking a Part Time Sales Admi...
AdminSalesSAPA rapidly growing FTSE 100 retail business are seeking a Head of Financial Analytics to join their team in London (hybrid remote). The successful candidate will lead an exceptional and highly-regarded...
A rapidly growing FTSE 100 retail business are seeking a Head of Business Intelligence to join their team in London (hybrid remote). The successful candidate will lead an exceptional and highly-regard...
Customer Insight Strategy Analyst Birmingham Up to 65k A customer focused role to provide insight to a large telecoms provider on data driven cus...
Our market leading client is looking to secure the services of a Senior Data Analyst to get involved in the shaping of a world class insights function. As the Senior Data Analyst, you will own the da...
Insight Analyst Up to £40k + Bonus, Pension & much more! Bristol, flexible working with 2 days per week in the office Leading Bristol bas...
What will you be doing Being a trusted advisor and recognised expert to Finance and technology colleagues regarding Finance business architecture strategy Driving business outcomes for the Financial C...
Business Intelligence Developer required by our client, a leading Inter-dealer broker, London based, offering a hybrid working model. You will be working with business stakeholders (predominately ops...
About Us We want to help small businesses win. Thats why were here. We connect small business owners to investors - to create jobs, support local communities and power economies - because we...
Company description: Exertis is an industry leading distributor of technology products and specialist services. Our customers are retailers and companies that resell technology products that people u...
£55,000 - £75,000 + Technical Progression + Pension + Holidays + Private Health Insurance + Bonus Warrington, Manchester - Hybrid/ Remote Exciting opportunity for an Sen...
JavaScriptPythonSimulationData ScienceTableauBristolconsultancyManchesterQlikviewSC clearancePowerBIMachine LearnStrategic Modelling consultantMy client is one of the UKs leading Business Intelligence consultancies . My client believes that data makes a difference. That it is the lifeblood that flows through an organisations systems and op...
bi - business intelligence - sql - data warehouse - datawarehouse - qlik - sap bo - business objects - tsql Title: Business Intelligence Consultant Location: Manche...
Business ObjectsData WarehousingETLInformaticaHave you work in Business Intelligence previously Do you want to work for an organisation that has a massive impact on the lives of every day people Are you available to start a new job role ASAP If s...
Have you work in Business Intelligence previously Do you want to work for an organisation that has a massive impact on the lives of every day people Are you available to start a new job role ASAP If s...
Power Apps Developer | QlikView l QlikSense l Tableau l Consultancy l Fully remote l £300 - £325 per day l Inside IR35 Method Resourcing are proud to be wo...
ROLE: Database Analyst / Administrator DBA LOCATION: Wakefield SKILLS: MSSQL Server estate DESCRIPTION: Lets be honest, you don...
Crystal ReportsSQLSql ServerQlikViewDBAMaximus UK is one of the largest providers of employment, health and disability support programmes across England, Scotland and Wales. Operating from more than 270 locations nationwide, Maximus UK emp...
Are you passionate about Business Intelligence, and Data & Analytics Do you have a strong knowledge of Qlik, and/or Power BIDo you enjoy working on a diverse range of projects and supporting customers...
Data & Analytics Consultant, SQL, BI, consulting London £55,000 - £70,000 + Bonus and Benefits Package Data and Analytic, Business Intelligence, BI, MDM, Data Quality, Data Governance...
AnalyticsBusiness IntelligenceFinancial ServicesOracleSAPSQLData QualityDWHTableauData GovernanceMDMData WarehouseQlikviewAnalytics.Data and AnalyticA superb opportunity for a BI Developer to join a leading HealthTech business that are investing millions within their data practice. Client Details The client is a health & life sc...
Data Engineer Up to £55,000 My client is one of the fastest growing data consultancies in the UK. They are work closely with financial services companies acro...
PythonSQLAzureAWSBI Developer. £45k - £50k + Benefits Package. Remote based role. Permanent. T6/MN/18171. Leading international FMCG organisation is seeking to secure an experienced BI...
SQL BI Power BI T-SQLThis is a 4 - 5 month role assisting with the production of the Annual Accounts. Client Details My client is a Public Sector organisation based in Cardiff Description financial accountantyear end accountant
Travelport is a place of opportunity. Its our incredible team that makes our company great - our people drive our winning culture. Whats Travelport Travelport is a...
Client of mine based just outside Luton are looking for a Qliksense developer to join their team. You will be working on the end-to-end solution of some large scale projects. Key skills requ...
I am currently helping a NHS Trust recruit for an information Analyst. Key Responsibilities:
Universal Analytics Analyst £40,000 - £50,000 + Benefits London (Hybrid) The Company This Universal Analytics Anal...
PythonSQLTableauQlikviewPerformance Analyst £32,000 - £45,000 + Benefits London (Hybrid) The Company This Performance Analyst role operate...
SQLTableauData VisualisationQlikviewThird Square are delighted to be partnering with this leading Publishing company based in London. JOB PURPOSE The Systems Data Analyst is responsible for the needs of the global data warehouse and b...
AgileData AnalysisETLSQLQlikViewOne of Midlands leading software service vendors require a talented BI developer to develop a complex advanced applications, ETL packages, SQL queries and Databases that provide the foundation for the...
Business IntelligenceETLAzurePower BIA well regarded provider of specialist loans and mortgages is Looking for a new Business MI Analyst to joint their growing team. Client Details Business MI Analyst - Secured...
MI AND BIAccount Manager - Luxury Brand - Midlands / North West / Yorkshire Theres nothing worse than representing a product or brand that you dont believe in, is there Well, thats not a pro...
Account ManagerMicrosoft OfficeReportsSalesSenior Operations Analyst Hybrid - working from home with occasional visits to a BCA location £45,000 - £55,000 per annum + car allowance +...
Account Manager - Luxury Brand - Midlands / North West / Yorkshire Theres nothing worse than representing a product or brand that you dont believe in, is there Well, thats not a pro...
Account ManagerMicrosoft OfficeReportsSalesSenior Data Analyst Based at BCA Birmingham Up to £45,000 per annum + car allowance + benefits 40 hours per week MondayFriday...
The Company Axon Moore are recruiting a Commercial Finance Business Analyst for a very well established and exciting group of companies based in Rochdale. Established over generation...
Badenoch & Clark are partnered with a large Telecoms company who are currently looking for a Finance Business Partner to join them on an initial 3 month contract (scope for extension based on project)...
Finance Business PartnerStaff365 are looking to recruit an Administrator for our client based in Leeds LS9
Your opportunity Our business has invested heavily in a state-of-art Customer Relationship Management (CRM) platform - creating multiple opportunities to develop deep analysi...
Performance Reporting - To manage the periodic reporting process, ensuring that the information generated is used to challenge performance and drive action. To generate ad-hoc information (normally ov...
AuditControlsManufacturingQualified (ACA/ACCA/CIMA)Finance Manager (3 directs)Hyrbrid WorkingAt Operate, we are significantly growing our Data Visualisation practice to support the firm in meeting new market demands and opportunities. As such, we are now looking to recruit Data Intelligence S...
Salary: £24-25K per annum Location: Kettering 21 Days Holiday Working hours 8.005.30pm day Friday once a Month Summary of Role My client ...
My client is seeking a Graduate Data Scientist to join their expanding Data Analytics Team in Birmngham. The company are looking for a recent graduate in Mathematics, Statistics, Comp...
Data AnalystAn excellent opportunity has arisen for a Newly Qualified accountant to join a market leading Corporate Finance House within their growing M&A financial modelling team based in Birmingham. This team ...
SQLVBATableaufinancial modellingm&avaluationsbusiness modellingcorporate financeLead AdvisoryQlikviewAlteryxbusiness valuationsPower BIHead of IT Systems Merseyside To £65,000 + Bonus, Private Healthcare + Excellent Benefits Our client is a well-established food prod...
CRMERPSoftwareSQLMy client is seeking a Graduate Data Scientist to join their expanding Data Analytics Team in Leeds. The company are looking for a recent graduate in Mathematics, Statistics, Computer...
Data ScientistMy client is seeking a Graduate Data Scientist to join their expanding Data Analytics Team in Manchester. The company are looking for a recent graduate in Mathematics, Statistics, Com...
Data ScientistData Analytics/Analyst Liverpool/Remote £9.92 per hour PAYE A Data Analytics Assistant is required for our client based in Liverpool. You will be joining the Data Analytics Hub based in centra...
analystexceldataanalyticsPurpose of Role To own and manager the ongoing architecture and development of our BI, Reporting and analytics platforms as well as supporting our live website Databases. Jo...
(Junior-Mid) Data Analyst | 90% Remote | To £39k I am working with a growing nationwide business who are looking to expand their Decision Intelligence team with a Junior-Mid lev...
PythonSQLStakeholder ManagementData AnalystPower BISenior Data Analyst | 90% Remote | To £55k + car allowance I am working with a growing nationwide business who are looking to expand their Decision Intelligence team with a ...
PythonSQLStakeholder ManagementData AnalystPower BIWe are seeking an IT Help Desk Manager with experience working in a Windows domain environment to:
Who are we We want to help small businesses win. Thats why were here. We connect small business owners to investors - to create jobs, help families and power economies - because we believe that people...
Data Modeller and Power BI Developer -4+month Contract - £450-£500/day My client is a leading Asset Management company who invest heavily in bringing together business...
Senior FP&A Analyst (Flexible Working) | Leicestershire, East Midlands | Manufacturing Sector We are delighted to be supporting a longstanding client in what is an extremely importa...
Business Intelligence (BI) Developer - Qliksense; Qlikview, Dashboards, Reports, Data analysis, Netezza Datamarts, Oracle, SQL Server. Stakeholder Engagement. c.65k +Excellent Benefits. City of Lo...
Our client has an opportunity for an Assistant Accountant to support the Central Group Finance Team which works across multiple regions. You can be based in Holborn, London W1 or Wyboston Lakes in Bed...
AccountancyPart QualifiedTrial BalanceVATMonth End CloseMy client is looking to add a high calibre data driven BI professional to high performing Commercial Analytics function. The successful candidate will support a fast-paced business area providing Mana...
Business IntelligenceData ManagementData VisualizationData IntegrationOur client is looking to recruit a Finance Analyst on an initial 12 month contract. This is to assist with system implementations Client Details Our client is a global business who ...
Finance AnalystSystems AccountantFinance Business AnalystA business analyst who will be responsible for a range of business information activities, with an emphasis on sales forecasting and SQL use. Client Details Leading manufacturers an...
Business Analysis / SQL / Qlikview / Vanguard / ForecastingBusiness Intelligence Consultant Are you passionate about Business Intelligence and Data Analytics Do you enjoy working on a diverse range of projects and supporting customers in mak...
© 2019 Naukrijobs All Rights Reserved